Lineage for d3mpoa_ (3mpo A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011283Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1011284Protein automated matches [190447] (20 species)
    not a true protein
  7. 1011334Species Lactobacillus brevis [TaxId:387344] [189330] (1 PDB entry)
  8. 1011335Domain d3mpoa_: 3mpo A: [181485]
    automated match to d1rkqa_

Details for d3mpoa_

PDB Entry: 3mpo (more details), 2.9 Å

PDB Description: The crystal structure of a hydrolase from Lactobacillus brevis
PDB Compounds: (A:) Predicted hydrolase of the HAD superfamily

SCOPe Domain Sequences for d3mpoa_:

Sequence, based on SEQRES records: (download)

>d3mpoa_ c.108.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]}
ikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamdidgd
dqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdis
aytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqs
apyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgnaide
vkeaaqavtltnaengvaaair

Sequence, based on observed residues (ATOM records): (download)

>d3mpoa_ c.108.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]}
ikliaidiaqatidavqaakaqgikvvlctgrpltgvqpyldamdidgddqyaitfngsv
aqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdisaytiaesylvr
mliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqsapyfievmnrr
askggtlselvdqlgltaddvmtlqgndltmikyaglgvamidevkeaaqavtgvaaair

SCOPe Domain Coordinates for d3mpoa_:

Click to download the PDB-style file with coordinates for d3mpoa_.
(The format of our PDB-style files is described here.)

Timeline for d3mpoa_: