Lineage for d1hm6b_ (1hm6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717091Protein Annexin I [47876] (2 species)
  7. 2717095Species Pig (Sus scrofa) [TaxId:9823] [47878] (2 PDB entries)
  8. 2717097Domain d1hm6b_: 1hm6 B: [18148]
    complexed with so4

Details for d1hm6b_

PDB Entry: 1hm6 (more details), 1.8 Å

PDB Description: x-ray structure of full-length annexin 1
PDB Compounds: (B:) annexin 1

SCOPe Domain Sequences for d1hm6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm6b_ a.65.1.1 (B:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]}
amvseflkqawfidneeqeyiktvkgskggpgsavspyptfnpssdvealhkaitvkgvd
eatiieiltkrtnaqrqqikaaylqekgkpldealkkaltghleevalallktpaqfdad
elraamkglgtdedtlneilasrtnreireinrvykeelkrdlakditsdtsgdyqkall
slakgdrsedlainddladtdaralyeagerrkgtdlnvfitilttrsyphlrrvfqkys
kyskhdmnkvldlelkgdiencltvvvkcatskpmffaeklhqamkgigtrhktlirimv
srseidmndikacyqklygislcqaildetkgdyekilvalcg

SCOPe Domain Coordinates for d1hm6b_:

Click to download the PDB-style file with coordinates for d1hm6b_.
(The format of our PDB-style files is described here.)

Timeline for d1hm6b_: