SCOPe 2.07: Domain d3mpea_: 3mpe A:

Lineage for d3mpea_ (3mpe A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 protein domains)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d3mpea_: 3mpe A: [181479]
   automated match to d1gloa_
   complexed with n2a; mutant

Details for d3mpea_

PDB Entry: 3mpe, 2.25 Å

PDB Description: crystal structure of human cathepsin-s c25s mutant with bound drug

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d3mpea_:

Sequence; same for both SEQRES and ATOM records:

>d3mpea_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
ilpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcste
kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
wlvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d3mpea_:

• d3mpea_ first appeared in SCOPe 2.01
  
• d3mpea_ appears in SCOPe 2.06