Lineage for d3mp7a1 (3mp7 A:26-468)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256123Fold f.41: Preprotein translocase SecY subunit [103490] (1 superfamily)
    10 transmembrane helices forming of a gated channel
  4. 2256124Superfamily f.41.1: Preprotein translocase SecY subunit [103491] (2 families) (S)
    duplication: consists of two similar structural parts
  5. 2256133Family f.41.1.0: automated matches [191647] (1 protein)
    not a true family
  6. 2256134Protein automated matches [191192] (2 species)
    not a true protein
  7. 2256135Species Pyrococcus furiosus [TaxId:2261] [189488] (1 PDB entry)
  8. 2256136Domain d3mp7a1: 3mp7 A:26-468 [181473]
    Other proteins in same PDB: d3mp7a2
    automated match to d1rhza_

Details for d3mp7a1

PDB Entry: 3mp7 (more details), 2.9 Å

PDB Description: lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
PDB Compounds: (A:) Preprotein translocase subunit secY

SCOPe Domain Sequences for d3mp7a1:

Sequence, based on SEQRES records: (download)

>d3mp7a1 f.41.1.0 (A:26-468) automated matches {Pyrococcus furiosus [TaxId: 2261]}
lrerfmwtgvalilyyvlaeipvygiperiqdyfqflrvvlagrngsiltlgigpivtag
iilqllvgseiikldlanpedrrfyqalqrvfsvfmcffeaavwilggafgrvgvdvtya
iavlmilqlamggivliildelvskwgigsgislfiaagvsqtiltrslnpltdpniidp
ltgqpaivgaipyfiqhilkgdlwgaiyrggsapdmlsvvativvffivvyfesmrveip
lgyrgvtvrgsypirflyvsnipiiltfalyaniqlwarvldrlghpwlgrfdpttgspi
sgfvlyvipprnifsvidnpvraivyliltvifsllfgylwveltgldarsiarqlqrag
lqipgfrrdprtlekvlqryipyvtfwgsltvaliavladflgalgtgtgilltvgilyr
fyeeiareqitemfpalrklfga

Sequence, based on observed residues (ATOM records): (download)

>d3mp7a1 f.41.1.0 (A:26-468) automated matches {Pyrococcus furiosus [TaxId: 2261]}
lrerfmwtgvalilyyvlaeipvygiperiqdyfqflrvvlagrngsiltlgigpivtag
iilqlqrvfsvfmcffeaavwilggafgrvaiavlmilqlamggivliildelvskwgig
sgislfiaagvsqtiltrslnpltdpnpltgqpaivgaipyfiqhilkgdlwgaiyrggs
apdmlsvvativvffivvyfesmrveiypirflyvsnipiiltfalyaniqlwarvldrl
ghpwlgrfdpttgspisgfvlyvipprnifsvidnpvraivyliltvifsllfgylwvel
tgldarsiaripgfrrdprtlekpyvtfwgsltvaliavladflgalgtgtgilltvgil
yrfyeeiareqitemfpalrklfga

SCOPe Domain Coordinates for d3mp7a1:

Click to download the PDB-style file with coordinates for d3mp7a1.
(The format of our PDB-style files is described here.)

Timeline for d3mp7a1: