SCOPe 2.01: Domain d3mozb_: 3moz B:

Lineage for d3mozb_ (3moz B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (1 protein)

6. Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)

7. Species Selenomonas ruminantium [TaxId:971] [117585] (10 PDB entries)
   Uniprot Q7WUJ1 34-346

8. Domain d3mozb_: 3moz B: [181472]
   automated match to d1u24a_
   complexed with 5ip, act, cl, gol, po4

Details for d3mozb_

PDB Entry: 3moz, 1.6 Å

PDB Description: structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,2,3,5,6)pentakisphosphate

PDB Compounds: (B:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d3mozb_:

Sequence; same for both SEQRES and ATOM records:

>d3mozb_ c.45.1.4 (B:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatdhvwptpenidrflafyrtlpqdawlhfhaeagvgrttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpaka

Timeline for d3mozb_:

• d3mozb_ is new in SCOPe 2.01-stable
  
• d3mozb_ appears in SCOPe 2.02
  
• d3mozb_ appears in the current release, SCOPe 2.08