Lineage for d3moua_ (3mou A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 901863Protein Dehaloperoxidase [46530] (1 species)
  7. 901864Species Amphitrite ornata [TaxId:129555] [46531] (16 PDB entries)
  8. 901881Domain d3moua_: 3mou A: [181469]
    automated match to d1ew6a_
    complexed with hem, so4, xe

Details for d3moua_

PDB Entry: 3mou (more details), 1.71 Å

PDB Description: Characterization of the Inhibitor Binding Site of the Dehaloperoxidase-Hemoglobin from Amphitrite ornata using High-Pressure Xenon Derivatization
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3moua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3moua_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3moua_:

Click to download the PDB-style file with coordinates for d3moua_.
(The format of our PDB-style files is described here.)

Timeline for d3moua_: