Lineage for d3morb_ (3mor B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015509Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1015510Protein automated matches [190230] (9 species)
    not a true protein
  7. 1015548Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189337] (2 PDB entries)
  8. 1015552Domain d3morb_: 3mor B: [181468]
    automated match to d1pbha_
    complexed with cl, gol, na

Details for d3morb_

PDB Entry: 3mor (more details), 2.55 Å

PDB Description: crystal structure of cathepsin b from trypanosoma brucei
PDB Compounds: (B:) Cathepsin B-like cysteine protease

SCOPe Domain Sequences for d3morb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3morb_ d.3.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
skngyppcsqfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
rgssecgiedggsagiplap

SCOPe Domain Coordinates for d3morb_:

Click to download the PDB-style file with coordinates for d3morb_.
(The format of our PDB-style files is described here.)

Timeline for d3morb_: