SCOPe 2.06: Domain d3mora_: 3mor A:

Lineage for d3mora_ (3mor A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (20 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189337] (2 PDB entries)

8. Domain d3mora_: 3mor A: [181467]
   automated match to d1pbha_
   complexed with cl, gol, na

Details for d3mora_

PDB Entry: 3mor, 2.55 Å

PDB Description: crystal structure of cathepsin b from trypanosoma brucei

PDB Compounds: (A:) Cathepsin B-like cysteine protease

SCOPe Domain Sequences for d3mora_:

Sequence; same for both SEQRES and ATOM records:

>d3mora_ d.3.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
skngyppcsqfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
rgssecgiedggsagiplap

Timeline for d3mora_:

• d3mora_ first appeared in SCOPe 2.01
  
• d3mora_ appears in SCOPe 2.05
  
• d3mora_ appears in SCOPe 2.07
  
• d3mora_ appears in the current release, SCOPe 2.08