SCOPe 2.08: Domain d3mooa_: 3moo A:

Lineage for d3mooa_ (3moo A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d3mooa_: 3moo A: [181465]
   automated match to d1iw1a_
   complexed with azi, so4, vea

Details for d3mooa_

PDB Entry: 3moo, 1.71 Å

PDB Description: crystal structure of the hmuo, heme oxygenase from corynebacterium diphtheriae, in complex with azide-bound verdoheme

PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d3mooa_:

Sequence; same for both SEQRES and ATOM records:

>d3mooa_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d3mooa_:

• d3mooa_ first appeared in SCOPe 2.01
  
• d3mooa_ appears in SCOPe 2.07