Lineage for d1bo9a_ (1bo9 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1738959Protein Annexin I [47876] (2 species)
  7. 1738960Species Human (Homo sapiens) [TaxId:9606] [47877] (2 PDB entries)
  8. 1738962Domain d1bo9a_: 1bo9 A: [18146]
    domain 1 only

Details for d1bo9a_

PDB Entry: 1bo9 (more details)

PDB Description: nmr solution structure of domain 1 of human annexin i
PDB Compounds: (A:) protein (annexin I)

SCOPe Domain Sequences for d1bo9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]}
tfnpssdvaalhkaimvkgvdeatiidiltkrnnaqrqqikaaylqetgkpldetlkkal
tghleevvlallk

SCOPe Domain Coordinates for d1bo9a_:

Click to download the PDB-style file with coordinates for d1bo9a_.
(The format of our PDB-style files is described here.)

Timeline for d1bo9a_: