![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
![]() | Superfamily a.65.1: Annexin [47874] (2 families) ![]() duplication: consists of four domains of the same fold |
![]() | Family a.65.1.1: Annexin [47875] (10 proteins) |
![]() | Protein Annexin I [47876] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47877] (2 PDB entries) |
![]() | Domain d1bo9a_: 1bo9 A: [18146] domain 1 only fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1bo9 (more details)
SCOPe Domain Sequences for d1bo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} tfnpssdvaalhkaimvkgvdeatiidiltkrnnaqrqqikaaylqetgkpldetlkkal tghleevvlallk
Timeline for d1bo9a_: