SCOPe 2.06: Domain d3mnpa1: 3mnp A:527-782

Lineage for d3mnpa1 (3mnp A:527-782)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189464] (4 PDB entries)

8. Domain d3mnpa1: 3mnp A:527-782 [181456]
   Other proteins in same PDB: d3mnpa2
   automated match to d1m2za_
   complexed with dex, gol, scn; mutant

Details for d3mnpa1

PDB Entry: 3mnp, 1.5 Å

PDB Description: Crystal structure of the agonist form of mouse glucocorticoid receptor stabilized by (A611V, V708A, E711G) mutations at 1.50A

PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d3mnpa1:

Sequence; same for both SEQRES and ATOM records:

>d3mnpa1 a.123.1.1 (A:527-782) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpaalpqltptlvslleviepevlyagydssvpdsawrimttlnmlggrqviaavkwaka
ipgfrnlhlddqmtllqyswmflmvfalgwrsyrqasgnllcfapdliineqrmtlpcmy
dqckhmlfistelqrlqvsyeeylcmktllllssvpkeglksqelfdeirmtyikelgka
iakrggnssqnwqrfyqltklldsmhdvvenllsycfqtfldksmsiefpemlaeiitnq
ipkysngnikkllfhq

Timeline for d3mnpa1:

• d3mnpa1 first appeared in SCOPe 2.01, called d3mnpa_
  
• d3mnpa1 was called d3mnpa_ in SCOPe 2.05
  
• d3mnpa1 appears in SCOPe 2.07
  
• d3mnpa1 appears in the current release, SCOPe 2.08