Lineage for d3mnpa1 (3mnp A:527-782)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729930Species Mouse (Mus musculus) [TaxId:10090] [189464] (4 PDB entries)
  8. 2729931Domain d3mnpa1: 3mnp A:527-782 [181456]
    Other proteins in same PDB: d3mnpa2
    automated match to d1m2za_
    complexed with dex, gol, scn; mutant

Details for d3mnpa1

PDB Entry: 3mnp (more details), 1.5 Å

PDB Description: Crystal structure of the agonist form of mouse glucocorticoid receptor stabilized by (A611V, V708A, E711G) mutations at 1.50A
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d3mnpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mnpa1 a.123.1.1 (A:527-782) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpaalpqltptlvslleviepevlyagydssvpdsawrimttlnmlggrqviaavkwaka
ipgfrnlhlddqmtllqyswmflmvfalgwrsyrqasgnllcfapdliineqrmtlpcmy
dqckhmlfistelqrlqvsyeeylcmktllllssvpkeglksqelfdeirmtyikelgka
iakrggnssqnwqrfyqltklldsmhdvvenllsycfqtfldksmsiefpemlaeiitnq
ipkysngnikkllfhq

SCOPe Domain Coordinates for d3mnpa1:

Click to download the PDB-style file with coordinates for d3mnpa1.
(The format of our PDB-style files is described here.)

Timeline for d3mnpa1: