| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries) |
| Domain d3mnng_: 3mnn G: [181454] Other proteins in same PDB: d3mnna_, d3mnnb_, d3mnnd_, d3mnne_, d3mnnf_, d3mnnh_ automated match to d1kx5c_ protein/DNA complex; complexed with mg, mml, ptw, ru, so4 |
PDB Entry: 3mnn (more details), 2.5 Å
SCOPe Domain Sequences for d3mnng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mnng_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
Timeline for d3mnng_: