| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries) |
| Domain d3mnna_: 3mnn A: [181451] Other proteins in same PDB: d3mnnb_, d3mnnc_, d3mnnd_, d3mnnf_, d3mnng_, d3mnnh_ automated match to d1kx5a_ protein/DNA complex; complexed with mg, mml, ptw, ru, so4 |
PDB Entry: 3mnn (more details), 2.5 Å
SCOPe Domain Sequences for d3mnna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mnna_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirger
Timeline for d3mnna_: