Lineage for d1e68a_ (1e68 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330098Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2330188Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family) (S)
    automatically mapped to Pfam PF09221
  5. 2330189Family a.64.2.1: Bacteriocin AS-48 [47870] (2 proteins)
  6. 2330190Protein Bacteriocin AS-48 [47871] (1 species)
    cyclic peptide
  7. 2330191Species Enterococcus faecalis [TaxId:1351] [47872] (4 PDB entries)
  8. 2330202Domain d1e68a_: 1e68 A: [18144]
    CASP4

Details for d1e68a_

PDB Entry: 1e68 (more details)

PDB Description: solution structure of bacteriocin as-48
PDB Compounds: (A:) as-48 protein

SCOPe Domain Sequences for d1e68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e68a_ a.64.2.1 (A:) Bacteriocin AS-48 {Enterococcus faecalis [TaxId: 1351]}
makefgipaavagtvlnvveaggwvttivsiltavgsgglsllaaagresikaylkkeik
kkgkraviaw

SCOPe Domain Coordinates for d1e68a_:

Click to download the PDB-style file with coordinates for d1e68a_.
(The format of our PDB-style files is described here.)

Timeline for d1e68a_: