Lineage for d1e68a_ (1e68 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4565Fold a.64: Saposin-like [47861] (2 superfamilies)
  4. 4577Superfamily a.64.2: Bacteriocin AS-48 [47869] (1 family) (S)
  5. 4578Family a.64.2.1: Bacteriocin AS-48 [47870] (1 protein)
  6. 4579Protein Bacteriocin AS-48 [47871] (1 species)
  7. 4580Species Enterococcus faecalis [TaxId:1351] [47872] (1 PDB entry)
  8. 4581Domain d1e68a_: 1e68 A: [18144]

Details for d1e68a_

PDB Entry: 1e68 (more details)

PDB Description: solution structure of bacteriocin as-48

SCOP Domain Sequences for d1e68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e68a_ a.64.2.1 (A:) Bacteriocin AS-48 {Enterococcus faecalis}
makefgipaavagtvlnvveaggwvttivsiltavgsgglsllaaagresikaylkkeik
kkgkraviaw

SCOP Domain Coordinates for d1e68a_:

Click to download the PDB-style file with coordinates for d1e68a_.
(The format of our PDB-style files is described here.)

Timeline for d1e68a_: