Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (6 PDB entries) |
Domain d3mn0a_: 3mn0 A: [181439] automated match to d1ufpa_ complexed with cu, cyn, hem |
PDB Entry: 3mn0 (more details), 1.65 Å
SCOPe Domain Sequences for d3mn0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mn0a_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]} vlsegewqlvlhvwakveadvaghgqdieirlfkshpetlekhdrfkhlkteaemkased lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d3mn0a_: