SCOPe 2.08: Domain d3mn0a_: 3mn0 A:

Lineage for d3mn0a_ (3mn0 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)

8. Domain d3mn0a_: 3mn0 A: [181439]
   automated match to d1ufpa_
   complexed with cu, cyn, hem

Details for d3mn0a_

PDB Entry: 3mn0, 1.65 Å

PDB Description: introducing a 2-his-1-glu non-heme iron center into myoglobin confers nitric oxide reductase activity: cu(ii)-cn-febmb(-his) form

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3mn0a_:

Sequence; same for both SEQRES and ATOM records:

>d3mn0a_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdieirlfkshpetlekhdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d3mn0a_:

• d3mn0a_ first appeared in SCOPe 2.01
  
• d3mn0a_ appears in SCOPe 2.07