Lineage for d3mmxh_ (3mmx H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590385Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1590524Protein automated matches [190964] (2 species)
    not a true protein
  7. 1590525Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries)
  8. 1590543Domain d3mmxh_: 3mmx H: [181438]
    automated match to d1kama_
    complexed with cit, dms, k, kjz

Details for d3mmxh_

PDB Entry: 3mmx (more details), 2.55 Å

PDB Description: Bacillus anthracis NadD (baNadD) in complex with compound 1_02_3
PDB Compounds: (H:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d3mmxh_:

Sequence, based on SEQRES records: (download)

>d3mmxh_ c.26.1.3 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
ierngly

Sequence, based on observed residues (ATOM records): (download)

>d3mmxh_ c.26.1.3 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqiitsvesrlqmlelateaee
hfsicleelssytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvtfvgva
rpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyierngly

SCOPe Domain Coordinates for d3mmxh_:

Click to download the PDB-style file with coordinates for d3mmxh_.
(The format of our PDB-style files is described here.)

Timeline for d3mmxh_: