Lineage for d3mmxe_ (3mmx E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860573Protein automated matches [190964] (6 species)
    not a true protein
  7. 2860574Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries)
  8. 2860589Domain d3mmxe_: 3mmx E: [181435]
    automated match to d1kama_
    complexed with cit, dms, k, kjz

Details for d3mmxe_

PDB Entry: 3mmx (more details), 2.55 Å

PDB Description: Bacillus anthracis NadD (baNadD) in complex with compound 1_02_3
PDB Compounds: (E:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d3mmxe_:

Sequence, based on SEQRES records: (download)

>d3mmxe_ c.26.1.3 (E:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglye

Sequence, based on observed residues (ATOM records): (download)

>d3mmxe_ c.26.1.3 (E:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipitsvesrlqmlelateae
ehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldlvt
fvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyierngly
e

SCOPe Domain Coordinates for d3mmxe_:

Click to download the PDB-style file with coordinates for d3mmxe_.
(The format of our PDB-style files is described here.)

Timeline for d3mmxe_: