Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein automated matches [190964] (3 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries) |
Domain d3mmxb_: 3mmx B: [181432] automated match to d1kama_ complexed with cit, dms, k, kjz |
PDB Entry: 3mmx (more details), 2.55 Å
SCOPe Domain Sequences for d3mmxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmxb_ c.26.1.3 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy iernglye
Timeline for d3mmxb_: