Lineage for d3mmtc1 (3mmt C:1-340)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836135Species Bartonella henselae [TaxId:38323] [189345] (2 PDB entries)
  8. 2836142Domain d3mmtc1: 3mmt C:1-340 [181429]
    Other proteins in same PDB: d3mmta2, d3mmtb2, d3mmtc2, d3mmtd2
    automated match to d1j4ea_
    complexed with 2fp

Details for d3mmtc1

PDB Entry: 3mmt (more details), 2.35 Å

PDB Description: crystal structure of fructose bisphosphate aldolase from bartonella henselae, bound to fructose bisphosphate
PDB Compounds: (C:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3mmtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmtc1 c.1.10.0 (C:1-340) automated matches {Bartonella henselae [TaxId: 38323]}
mnerledialtlvgagkgilaadestatigkrfesigvectednrrayremlftakeame
saisgvilfdetlrqkastgqmltdlirdagavpgikvdtgakplaafpqetitegldgl
rerlkdyytlgarfakwraviaidaqtlptrgaisqnaqalaryaalcqeaglvpivepe
vlmdgpsrqhsitrcfevtkvvlhtvfkelfearvlfegmilkpnmvidgkdariasvee
vaektvhvlkqtvpaavpgiaflsggqtdeeatahlsamnalgalpwkltfsygralqaa
alkawagknenivvaqkafchrarmnhlaalgqwtkdqek

SCOPe Domain Coordinates for d3mmtc1:

Click to download the PDB-style file with coordinates for d3mmtc1.
(The format of our PDB-style files is described here.)

Timeline for d3mmtc1: