Lineage for d3mmda_ (3mmd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082649Protein Xylanase [51488] (6 species)
  7. 2082665Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (8 PDB entries)
    Uniprot P40943
  8. 2082668Domain d3mmda_: 3mmd A: [181418]
    automated match to d1hiza_
    complexed with cl, na, zn; mutant

Details for d3mmda_

PDB Entry: 3mmd (more details), 1.7 Å

PDB Description: Crystal structure of the W241A mutant of xylanase from Geobacillus stearothermophilus T-6 (XT6) complexed with hydrolyzed xylopentaose
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3mmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmda_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigapseaeie
ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

SCOPe Domain Coordinates for d3mmda_:

Click to download the PDB-style file with coordinates for d3mmda_.
(The format of our PDB-style files is described here.)

Timeline for d3mmda_: