SCOPe: Structural Classification of Proteins — extended. Release 2.04 (July 2014, new entries added 2014-09-11)
Search SCOPe (example):

Lineage for d3mmce3 (3mmc E:123-196,E:262-366)

  1. Root: SCOPe 2.04
  2. 1628094Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665882Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 1665883Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 1665884Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 protein domains)
  6. 1665906Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 1665907Species Archaeoglobus fulgidus [TaxId:2234] [160774] (8 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 1665915Domain d3mmce3: 3mmc E:123-196,E:262-366 [181417]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2
    automated match to d3mmcb3
    complexed with gol, sf4, srm

Details for d3mmce3

PDB Entry: 3mmc (more details), 2.04 Å
PDB Description: structure of the dissimilatory sulfite reductase from archaeoglobus fulgidus
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmce3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmce3 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3mmce3:

Click to download the PDB-style file with coordinates for d3mmce3.
(The format of our PDB-style files is described here.)

Timeline for d3mmce3:


SCOPe Copyright © 1994-2014 The SCOP and SCOPe authors
scope@compbio.berkeley.edu