SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mmce3 (3mmc E:123-196,E:262-366)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194130Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2194131Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2194132Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 protein domains)
  6. 2194154Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 2194155Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 2194165Domain d3mmce3: 3mmc E:123-196,E:262-366 [181417]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2
    automated match to d3mmcb3
    complexed with gol, sf4, srm

Details for d3mmce3

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmce3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmce3 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3mmce3:

Click to download the PDB-style file with coordinates for d3mmce3.
(The format of our PDB-style files is described here.)

Timeline for d3mmce3: