SCOPe: Structural Classification of Proteins — extended. Release 2.04 (July 2014, new entries added 2014-11-15)
Search SCOPe (example):

Lineage for d3mmce2 (3mmc E:4-122)

  1. Root: SCOPe 2.04
  2. 1628094Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645993Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650697Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 1650739Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 protein domains)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 1650761Protein Dissimilatory sulfite reductase subunit beta, DsrB [160340] (2 species)
  7. 1650762Species Archaeoglobus fulgidus [TaxId:2234] [160341] (8 PDB entries)
    Uniprot Q59110 4-122
  8. 1650770Domain d3mmce2: 3mmc E:4-122 [181416]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb1, d3mmcb3, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce3
    automated match to d3mmcb2
    complexed with gol, sf4, srm

Details for d3mmce2

PDB Entry: 3mmc (more details), 2.04 Å
PDB Description: structure of the dissimilatory sulfite reductase from archaeoglobus fulgidus
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmce2 d.58.36.2 (E:4-122) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdav

SCOPe Domain Coordinates for d3mmce2:

Click to download the PDB-style file with coordinates for d3mmce2.
(The format of our PDB-style files is described here.)

Timeline for d3mmce2:


SCOPe Copyright © 1994-2014 The SCOP and SCOPe authors
scope@compbio.berkeley.edu