SCOPe: Structural Classification of Proteins — extended. Release 2.03 (October 2013)
Search SCOPe (example):

Lineage for d3mmcd2 (3mmc D:1-166)

  1. Root: SCOPe 2.03
  2. 1389709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405694Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1409924Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 1409966Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 protein domains)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 1409967Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. 1409968Species Archaeoglobus fulgidus [TaxId:2234] [160338] (8 PDB entries)
    Uniprot Q59109 2-418
  8. 1409976Domain d3mmcd2: 3mmc D:1-166 [181413]
    Other proteins in same PDB: d3mmca1, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
    automated match to d3mmca2
    complexed with gol, sf4, srm

Details for d3mmcd2

PDB Entry: 3mmc (more details)
PDB Description: structure of the dissimilatory sulfite reductase from archaeoglobus fulgidus
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmcd2 d.58.36.2 (D:1-166) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsg

SCOPe Domain Coordinates for d3mmcd2:

Click to download the PDB-style file with coordinates for d3mmcd2.
(The format of our PDB-style files is described here.)

Timeline for d3mmcd2:


SCOPe Copyright © 1994-2014 The SCOP and SCOPe authors
scope@compbio.berkeley.edu