SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mmcd2 (3mmc D:1-166)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177432Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2177474Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 protein domains)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 2177475Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. 2177476Species Archaeoglobus fulgidus [TaxId:2234] [160338] (8 PDB entries)
    Uniprot Q59109 2-418
  8. 2177484Domain d3mmcd2: 3mmc D:1-166 [181413]
    Other proteins in same PDB: d3mmca1, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
    automated match to d3mmca2
    complexed with gol, sf4, srm

Details for d3mmcd2

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmcd2 d.58.36.2 (D:1-166) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsg

SCOPe Domain Coordinates for d3mmcd2:

Click to download the PDB-style file with coordinates for d3mmcd2.
(The format of our PDB-style files is described here.)

Timeline for d3mmcd2: