SCOPe: Structural Classification of Proteins — extended. Release 2.03 (October 2013)
Search SCOPe (example):

Lineage for d3mmcd1 (3mmc D:239-304)

  1. Root: SCOPe 2.03
  2. 1389709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405694Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1405695Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1405824Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 protein domains)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1405861Protein DsrA insert domain [160280] (2 species)
  7. 1405862Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries)
    Uniprot Q59109 240-305
  8. 1405870Domain d3mmcd1: 3mmc D:239-304 [181412]
    Other proteins in same PDB: d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
    automated match to d3mmca1
    complexed with gol, sf4, srm

Details for d3mmcd1

PDB Entry: 3mmc (more details)
PDB Description: structure of the dissimilatory sulfite reductase from archae fulgidus
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmcd1 d.58.1.5 (D:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOPe Domain Coordinates for d3mmcd1:

Click to download the PDB-style file with coordinates for d3mmcd1.
(The format of our PDB-style files is described here.)

Timeline for d3mmcd1:


SCOPe Copyright © 1994-2014 The SCOP and SCOPe authors
scope@compbio.berkeley.edu