Domain d3mmcd1: 3mmc D:239-304

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d3mmcd1 (3mmc D:239-304)

Root: SCOP 1.75B
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 protein domains)
members of this "family" may be more closely related to other ferredoxins than to each other
Protein DsrA insert domain [160280] (2 species)
Species Archaeoglobus fulgidus [TaxId:2234] [160282] (1 PDB entry)
Uniprot Q59109 240-305

Domain d3mmcd1: 3mmc D:239-304 [181412]
Other proteins in same PDB: d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
automatically matched to 3C7B A:239-304
complexed with gol, sf4, srm

PDB Entry: 3mmc (more details)
PDB Description: structure of the dissimilatory sulfite reductase from archae fulgidus
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOP Domain Sequences for d3mmcd1:
Sequence; same for both SEQRES and ATOM records: (download)

>d3mmcd1 d.58.1.5 (D:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]} kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka lkpgde

SCOP Domain Coordinates for d3mmcd1:

Click to download the PDB-style file with coordinates for d3mmcd1.
(The format of our PDB-style files is described here.)

Timeline for d3mmcd1:
d3mmcd1 appears in SCOP 1.75A

d3mmcd1
(click for larger image)

d3mmcd1 in context of chain
Domains from same chain:
d3mmcd2, d3mmcd3

d3mmcd1 in context of PDB
Domains from other chains:
d3mmca1, d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmce1, d3mmce2, d3mmce3