SCOPe: Structural Classification of Proteins — extended. Release 2.06 (February 2016)
Search SCOPe (example):

Lineage for d3mmcb3 (3mmc B:123-196,B:262-366)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194130Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2194131Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2194132Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 protein domains)
  6. 2194154Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 2194155Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 2194164Domain d3mmcb3: 3mmc B:123-196,B:262-366 [181411]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2
    complexed with gol, sf4, srm

Details for d3mmcb3

PDB Entry: 3mmc (more details), 2.04 Å
PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmcb3 d.134.1.1 (B:123-196,B:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3mmcb3:

Click to download the PDB-style file with coordinates for d3mmcb3.
(The format of our PDB-style files is described here.)

Timeline for d3mmcb3:


SCOPe Copyright © 1994-2016 The SCOP and SCOPe authors
scope@compbio.berkeley.edu