SCOPe 2.08: Domain d3mmcb3: 3mmc B:123-196,B:262-366

Lineage for d3mmcb3 (3mmc B:123-196,B:262-366)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families)
   duplication: contains two domains of this fold

5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)

6. Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries)
   Uniprot Q59110 123-196,262-366

8. Domain d3mmcb3: 3mmc B:123-196,B:262-366 [181411]
   Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2
   complexed with gol, sf4, srm

Details for d3mmcb3

PDB Entry: 3mmc, 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus

PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmcb3:

Sequence; same for both SEQRES and ATOM records:

>d3mmcb3 d.134.1.1 (B:123-196,B:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

Timeline for d3mmcb3:

• d3mmcb3 first appeared in SCOPe 2.01
  
• d3mmcb3 appears in SCOPe 2.07