Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3mmca3 (3mmc A:167-238,A:305-417)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family) (S)
    duplication: contains two domains of this fold
  5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 protein domains)
  6. Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [160779] (1 PDB entry)
    Uniprot Q59109 168-239,306-418
  8. Domain d3mmca3: 3mmc A:167-238,A:305-417 [181408]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmce1, d3mmce2, d3mmce3
    complexed with gol, sf4, srm

Details for d3mmca3

PDB Entry: 3mmc (more details)
PDB Description: structure of the dissimilatory sulfite reductase from archae fulgidus
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOP Domain Sequences for d3mmca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmca3 d.134.1.1 (A:167-238,A:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas
karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww
deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel
kkrgmw

SCOP Domain Coordinates for d3mmca3:

Click to download the PDB-style file with coordinates for d3mmca3.
(The format of our PDB-style files is described here.)

Timeline for d3mmca3:

d3mmca3 appears in SCOP 1.75A


d3mmca3
(click for larger image)


d3mmca3 in context of chain
Domains from same chain:
d3mmca1, d3mmca2


d3mmca3 in context of PDB
Domains from other chains:
d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu