![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
![]() | Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
![]() | Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
![]() | Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [160779] (8 PDB entries) Uniprot Q59109 168-239,306-418 |
![]() | Domain d3mmca3: 3mmc A:167-238,A:305-417 [181408] Other proteins in same PDB: d3mmca1, d3mmca2, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmce1, d3mmce2, d3mmce3 complexed with gol, sf4, srm |
PDB Entry: 3mmc (more details), 2.04 Å
SCOPe Domain Sequences for d3mmca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmca3 d.134.1.1 (A:167-238,A:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]} sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel kkrgmw
Timeline for d3mmca3: