SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mmca3 (3mmc A:167-238,A:305-417)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194130Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2194131Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2194132Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 protein domains)
  6. 2194133Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species)
  7. 2194134Species Archaeoglobus fulgidus [TaxId:2234] [160779] (8 PDB entries)
    Uniprot Q59109 168-239,306-418
  8. 2194141Domain d3mmca3: 3mmc A:167-238,A:305-417 [181408]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmce1, d3mmce2, d3mmce3
    complexed with gol, sf4, srm

Details for d3mmca3

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmca3 d.134.1.1 (A:167-238,A:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas
karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww
deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel
kkrgmw

SCOPe Domain Coordinates for d3mmca3:

Click to download the PDB-style file with coordinates for d3mmca3.
(The format of our PDB-style files is described here.)

Timeline for d3mmca3: