Lineage for d3mmca1 (3mmc A:239-304)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650266Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1650303Protein DsrA insert domain [160280] (2 species)
  7. 1650304Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries)
    Uniprot Q59109 240-305
  8. 1650311Domain d3mmca1: 3mmc A:239-304 [181406]
    Other proteins in same PDB: d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
    complexed with gol, sf4, srm

Details for d3mmca1

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmca1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOPe Domain Coordinates for d3mmca1:

Click to download the PDB-style file with coordinates for d3mmca1.
(The format of our PDB-style files is described here.)

Timeline for d3mmca1: