Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3mmca1 (3mmc A:239-304)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 protein domains)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. Protein DsrA insert domain [160280] (2 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [160282] (1 PDB entry)
    Uniprot Q59109 240-305
  8. Domain d3mmca1: 3mmc A:239-304 [181406]
    Other proteins in same PDB: d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
    complexed with gol, sf4, srm

Details for d3mmca1

PDB Entry: 3mmc (more details)
PDB Description: structure of the dissimilatory sulfite reductase from archae fulgidus
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOP Domain Sequences for d3mmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmca1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOP Domain Coordinates for d3mmca1:

Click to download the PDB-style file with coordinates for d3mmca1.
(The format of our PDB-style files is described here.)

Timeline for d3mmca1:

d3mmca1 appears in SCOP 1.75A


d3mmca1
(click for larger image)


d3mmca1 in context of chain
Domains from same chain:
d3mmca2, d3mmca3


d3mmca1 in context of PDB
Domains from other chains:
d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu