SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mmca1 (3mmc A:239-304)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172289Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2172425Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 protein domains)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2172462Protein DsrA insert domain [160280] (2 species)
  7. 2172463Species Archaeoglobus fulgidus [TaxId:2234] [160282] (8 PDB entries)
    Uniprot Q59109 240-305
  8. 2172470Domain d3mmca1: 3mmc A:239-304 [181406]
    Other proteins in same PDB: d3mmca2, d3mmca3, d3mmcb1, d3mmcb2, d3mmcb3, d3mmcd2, d3mmcd3, d3mmce1, d3mmce2, d3mmce3
    complexed with gol, sf4, srm

Details for d3mmca1

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmca1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
kddikvdqeavkeyaswmdienevvklcptgaikwdgkeltidnrecvrcmhcinkmpka
lkpgde

SCOPe Domain Coordinates for d3mmca1:

Click to download the PDB-style file with coordinates for d3mmca1.
(The format of our PDB-style files is described here.)

Timeline for d3mmca1: