SCOPe 2.04: Domain d3mm3a_: 3mm3 A:

Lineage for d3mm3a_ (3mm3 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
   Pfam PF04261

6. Protein Decolorizing peroxidase DyP [143268] (2 species)

7. Species Bjerkandera adusta [TaxId:5331] [224929] (5 PDB entries)

8. Domain d3mm3a_: 3mm3 A: [181405]
   automated match to d2d3qa1
   complexed with cyn, hem

Details for d3mm3a_

PDB Entry: 3mm3, 1.4 Å

PDB Description: dye-decolorizing peroxidase (dyp) d171n in complex with cyanide

PDB Compounds: (A:) DyP

SCOPe Domain Sequences for d3mm3a_:

Sequence; same for both SEQRES and ATOM records:

>d3mm3a_ d.58.4.14 (A:) Decolorizing peroxidase DyP {Bjerkandera adusta [TaxId: 5331]}
tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgflngisqpsvtgwet
tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
ggeyfflpsisaltatiaa

Timeline for d3mm3a_:

• d3mm3a_ first appeared in SCOPe 2.01
  
• d3mm3a_ appears in SCOPe 2.03
  
• d3mm3a_ appears in SCOPe 2.05
  
• d3mm3a_ appears in the current release, SCOPe 2.08