Lineage for d3mm2a_ (3mm2 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173090Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 protein domains)
    Pfam PF04261
  6. 2173091Protein Decolorizing peroxidase DyP [143268] (2 species)
  7. 2173092Species Bjerkandera adusta [TaxId:5331] [224929] (5 PDB entries)
  8. 2173096Domain d3mm2a_: 3mm2 A: [181404]
    automated match to d2d3qa1
    complexed with cyn, hem, nag

Details for d3mm2a_

PDB Entry: 3mm2 (more details), 1.45 Å

PDB Description: dye-decolorizing peroxidase (dyp) in complex with cyanide
PDB Compounds: (A:) DyP

SCOPe Domain Sequences for d3mm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mm2a_ d.58.4.14 (A:) Decolorizing peroxidase DyP {Bjerkandera adusta [TaxId: 5331]}
tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
ggeyfflpsisaltatiaa

SCOPe Domain Coordinates for d3mm2a_:

Click to download the PDB-style file with coordinates for d3mm2a_.
(The format of our PDB-style files is described here.)

Timeline for d3mm2a_: