Lineage for d3mm0i_ (3mm0 I:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325094Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1325401Protein automated matches [190191] (2 species)
    not a true protein
  7. 1325402Species Chicken (Gallus gallus) [TaxId:9031] [186931] (22 PDB entries)
  8. 1325470Domain d3mm0i_: 3mm0 I: [181399]
    automated match to d1rava_

Details for d3mm0i_

PDB Entry: 3mm0 (more details), 2.7 Å

PDB Description: crystal structure of chimeric avidin
PDB Compounds: (I:) Avidin, Avidin-related protein 4/5

SCOPe Domain Sequences for d3mm0i_:

Sequence, based on SEQRES records: (download)

>d3mm0i_ b.61.1.1 (I:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftrl

Sequence, based on observed residues (ATOM records): (download)

>d3mm0i_ b.61.1.1 (I:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
gftvnwkfsesttvftgqcfidrgkevlktmwllrssvndigddwkatrvgyniftrl

SCOPe Domain Coordinates for d3mm0i_:

Click to download the PDB-style file with coordinates for d3mm0i_.
(The format of our PDB-style files is described here.)

Timeline for d3mm0i_: