Lineage for d3mlmb_ (3mlm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346231Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (3 PDB entries)
  8. 2346235Domain d3mlmb_: 3mlm B: [181390]
    automated match to d1pc9a_
    complexed with myr, so4

Details for d3mlmb_

PDB Entry: 3mlm (more details), 2.21 Å

PDB Description: Crystal structure of Bn IV in complex with myristic acid: A Lys49 myotoxic phospholipase A2 from Bothrops neuwiedi venom
PDB Compounds: (B:) BN-IV Lys-49 Phospholipase A2

SCOPe Domain Sequences for d3mlmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlmb_ a.133.1.2 (B:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId: 95649]}
slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkitgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d3mlmb_:

Click to download the PDB-style file with coordinates for d3mlmb_.
(The format of our PDB-style files is described here.)

Timeline for d3mlmb_: