![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.292: HP0242-like [158751] (1 superfamily) multihelical; intertwined homodimer of four-helical subunits, forming catenated triangular ring-like structures; pseudo knot |
![]() | Superfamily a.292.1: HP0242-like [158752] (1 family) ![]() automatically mapped to Pfam PF09442 |
![]() | Family a.292.1.1: HP0242-like [158753] (1 protein) Pfam PF09442; DUF2018 |
![]() | Protein Hypothetical protein HP0242 [158754] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [158755] (4 PDB entries) Uniprot O25025 1-93! Uniprot O25025 13-92 |
![]() | Domain d3mlia_: 3mli A: [181385] Other proteins in same PDB: d3mlib2, d3mlic2, d3mlid2 automated match to d2bo3a1 complexed with ca |
PDB Entry: 3mli (more details), 2.9 Å
SCOPe Domain Sequences for d3mlia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mlia_ a.292.1.1 (A:) Hypothetical protein HP0242 {Helicobacter pylori [TaxId: 210]} dyseleifegnpldkwndiifhaskklskkelerllellalcetfiekedleekfesfak alrideelqqkiesrktdiviqsmanilsgl
Timeline for d3mlia_: