SCOPe 2.04: Domain d3mlbb_: 3mlb B:

Lineage for d3mlbb_ (3mlb B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (2 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries)

8. Domain d3mlbb_: 3mlb B: [181379]
   automated match to d1kama_
   complexed with fmt, k, ljz

Details for d3mlbb_

PDB Entry: 3mlb, 1.8 Å

PDB Description: BaNadD in complex with inhibitor 1_02_1

PDB Compounds: (B:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d3mlbb_:

Sequence, based on SEQRES records:

>d3mlbb_ c.26.1.3 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

Sequence, based on observed residues (ATOM records):

>d3mlbb_ c.26.1.3 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphnitsvesrlqmlelat
eaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealld
lvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyiern
glyes

Timeline for d3mlbb_:

• d3mlbb_ first appeared in SCOPe 2.01
  
• d3mlbb_ appears in SCOPe 2.03
  
• d3mlbb_ appears in SCOPe 2.05
  
• d3mlbb_ appears in the current release, SCOPe 2.08