SCOPe 2.06: Domain d1qgtc_: 1qgt C:

Lineage for d1qgtc_ (1qgt C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein Hepatitis B viral capsid (hbcag) [47854] (1 species)

7. Species Hepatitis B virus [TaxId:10407] [47855] (1 PDB entry)

8. Domain d1qgtc_: 1qgt C: [18137]

Details for d1qgtc_

PDB Entry: 1qgt, 3.3 Å

PDB Description: human hepatitis b viral capsid (hbcag)

PDB Compounds: (C:) protein (hbv capsid protein)

SCOPe Domain Sequences for d1qgtc_:

Sequence; same for both SEQRES and ATOM records:

>d1qgtc_ a.62.1.1 (C:) Hepatitis B viral capsid (hbcag) {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
cwgelmtlatwvgnnledpasrdlvvnyvntnmglkirqllwfhiscltfgretvleylv
sfgvwirtppayrppnapilst

Timeline for d1qgtc_:

• d1qgtc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgtc_ appears in SCOPe 2.05
  
• d1qgtc_ appears in SCOPe 2.07
  
• d1qgtc_ appears in the current release, SCOPe 2.08