SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1qgtc_ (1qgt C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999890Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 1999891Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 1999892Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 protein domains)
  6. 1999893Protein Hepatitis B viral capsid (hbcag) [47854] (1 species)
  7. 1999894Species Hepatitis B virus [TaxId:10407] [47855] (1 PDB entry)
  8. 1999897Domain d1qgtc_: 1qgt C: [18137]

Details for d1qgtc_

PDB Entry: 1qgt (more details), 3.3 Å

PDB Description: human hepatitis b viral capsid (hbcag)
PDB Compounds: (C:) protein (hbv capsid protein)

SCOPe Domain Sequences for d1qgtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgtc_ a.62.1.1 (C:) Hepatitis B viral capsid (hbcag) {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
cwgelmtlatwvgnnledpasrdlvvnyvntnmglkirqllwfhiscltfgretvleylv
sfgvwirtppayrppnapilst

SCOPe Domain Coordinates for d1qgtc_:

Click to download the PDB-style file with coordinates for d1qgtc_.
(The format of our PDB-style files is described here.)

Timeline for d1qgtc_: