![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins) |
![]() | Protein Uncharacterized protein EAJ56179 [159341] (1 species) |
![]() | Species Unidentified organism [TaxId:32644] [159342] (1 PDB entry) 94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1) |
![]() | Domain d3mkvf1: 3mkv F:2-57,F:369-414 [181368] Other proteins in same PDB: d3mkva2, d3mkvb2, d3mkvc2, d3mkvd2, d3mkve2, d3mkvf2, d3mkvg2, d3mkvh2 automatically matched to 2R8C A:2-57,A:369-414 complexed with co3, gol, so4, zn |
PDB Entry: 3mkv (more details), 2.4 Å
SCOPe Domain Sequences for d3mkvf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mkvf1 b.92.1.9 (F:2-57,F:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpXriv pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
Timeline for d3mkvf1: