SCOPe 2.01: Domain d3mkvd1: 3mkv D:2-57,D:369-414

Lineage for d3mkvd1 (3mkv D:2-57,D:369-414)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)

6. Protein Uncharacterized protein EAJ56179 [159341] (1 species)

7. Species Unidentified organism [TaxId:32644] [159342] (1 PDB entry)
   94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1)

8. Domain d3mkvd1: 3mkv D:2-57,D:369-414 [181364]
   Other proteins in same PDB: d3mkva2, d3mkvb2, d3mkvc2, d3mkvd2, d3mkve2, d3mkvf2, d3mkvg2, d3mkvh2
   automatically matched to 2R8C A:2-57,A:369-414
   complexed with co3, gol, so4, zn

Details for d3mkvd1

PDB Entry: 3mkv, 2.4 Å

PDB Description: crystal structure of amidohydrolase eaj56179

PDB Compounds: (D:) putative amidohydrolase

SCOPe Domain Sequences for d3mkvd1:

Sequence; same for both SEQRES and ATOM records:

>d3mkvd1 b.92.1.9 (D:2-57,D:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]}
ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpXriv
pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele

Timeline for d3mkvd1:

• d3mkvd1 is new in SCOPe 2.01-stable
  
• d3mkvd1 appears in SCOPe 2.02
  
• d3mkvd1 appears in the current release, SCOPe 2.08