![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins) automatically mapped to Pfam PF01979 |
![]() | Protein Uncharacterized protein EAJ56179 [159413] (1 species) |
![]() | Species Unidentified organism [TaxId:32644] [159414] (1 PDB entry) 94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1) |
![]() | Domain d3mkvb2: 3mkv B:58-368 [181361] Other proteins in same PDB: d3mkva1, d3mkvb1, d3mkvc1, d3mkvd1, d3mkve1, d3mkvf1, d3mkvg1, d3mkvh1 automatically matched to 2R8C A:58-368 complexed with co3, gol, so4, zn |
PDB Entry: 3mkv (more details), 2.4 Å
SCOPe Domain Sequences for d3mkvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mkvb2 c.1.9.18 (B:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} glidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqav esglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrr avreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpa aiaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiak iadvhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativs aevlgmqdklg
Timeline for d3mkvb2: