Lineage for d3mkva2 (3mkv A:58-368)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 972096Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins)
  6. 972097Protein Uncharacterized protein EAJ56179 [159413] (1 species)
  7. 972098Species Unidentified organism [TaxId:32644] [159414] (1 PDB entry)
    94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1)
  8. 972099Domain d3mkva2: 3mkv A:58-368 [181359]
    Other proteins in same PDB: d3mkva1, d3mkvb1, d3mkvc1, d3mkvd1, d3mkve1, d3mkvf1, d3mkvg1, d3mkvh1
    complexed with co3, gol, so4, zn

Details for d3mkva2

PDB Entry: 3mkv (more details), 2.4 Å

PDB Description: crystal structure of amidohydrolase eaj56179
PDB Compounds: (A:) putative amidohydrolase

SCOPe Domain Sequences for d3mkva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkva2 c.1.9.18 (A:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]}
glidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqav
esglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrr
avreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpa
aiaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiak
iadvhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativs
aevlgmqdklg

SCOPe Domain Coordinates for d3mkva2:

Click to download the PDB-style file with coordinates for d3mkva2.
(The format of our PDB-style files is described here.)

Timeline for d3mkva2: