Lineage for d3mkva1 (3mkv A:1-57,A:369-414)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819337Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins)
  6. 2819338Protein Uncharacterized protein EAJ56179 [159341] (1 species)
  7. 2819339Species Unidentified organism [TaxId:32644] [159342] (1 PDB entry)
    94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1)
  8. 2819340Domain d3mkva1: 3mkv A:1-57,A:369-414 [181358]
    Other proteins in same PDB: d3mkva2, d3mkvb2, d3mkvc2, d3mkvd2, d3mkve2, d3mkvf2, d3mkvg2, d3mkvh2
    complexed with co3, gol, so4, zn

Details for d3mkva1

PDB Entry: 3mkv (more details), 2.4 Å

PDB Description: crystal structure of amidohydrolase eaj56179
PDB Compounds: (A:) putative amidohydrolase

SCOPe Domain Sequences for d3mkva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkva1 b.92.1.9 (A:1-57,A:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]}
lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpXri
vpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele

SCOPe Domain Coordinates for d3mkva1:

Click to download the PDB-style file with coordinates for d3mkva1.
(The format of our PDB-style files is described here.)

Timeline for d3mkva1: