Lineage for d3mknc_ (3mkn C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136762Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species)
  7. 2136763Species Escherichia coli [TaxId:562] [102634] (3 PDB entries)
  8. 2136770Domain d3mknc_: 3mkn C: [181356]
    automated match to d1q8fa_
    complexed with ca, dnb

Details for d3mknc_

PDB Entry: 3mkn (more details), 2 Å

PDB Description: Crystal structure of the E. coli pyrimidine nucleosidase YeiK bound to a competitive inhibitor
PDB Compounds: (C:) Putative uncharacterized protein YeiK

SCOPe Domain Sequences for d3mknc_:

Sequence, based on SEQRES records: (download)

>d3mknc_ c.70.1.1 (C:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]}
krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat
cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv
eecvrgyik

Sequence, based on observed residues (ATOM records): (download)

>d3mknc_ c.70.1.1 (C:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]}
krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
vyagmpqpimrqqivadtgldgpvfepltrqaesthavkyiidtlmasdgditlvpvgpl
sniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgvplvmm
gldltnqtvctpdviarmeraggpagelfsdimnftgpvhdatcigylinpdgiktqemy
vevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrgyik

SCOPe Domain Coordinates for d3mknc_:

Click to download the PDB-style file with coordinates for d3mknc_.
(The format of our PDB-style files is described here.)

Timeline for d3mknc_: