Lineage for d3mkma_ (3mkm A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180695Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 1180696Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 1180697Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
  6. 1180724Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species)
  7. 1180725Species Escherichia coli [TaxId:562] [102634] (4 PDB entries)
  8. 1180734Domain d3mkma_: 3mkm A: [181350]
    automated match to d1q8fa_
    complexed with ca

Details for d3mkma_

PDB Entry: 3mkm (more details), 2.2 Å

PDB Description: Crystal structure of the E. coli pyrimidine nucleoside hydrolase YeiK (Apo-form)
PDB Compounds: (A:) Putative uncharacterized protein YeiK

SCOPe Domain Sequences for d3mkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkma_ c.70.1.1 (A:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]}
mekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqklein
vpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgdit
lvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvfts
gvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhd
atcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwg
lveecvrgyik

SCOPe Domain Coordinates for d3mkma_:

Click to download the PDB-style file with coordinates for d3mkma_.
(The format of our PDB-style files is described here.)

Timeline for d3mkma_: