Lineage for d1qgta_ (1qgt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716878Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2716879Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2716880Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2716881Protein Hepatitis B viral capsid (hbcag) [47854] (1 species)
  7. 2716882Species Hepatitis B virus [TaxId:10407] [47855] (1 PDB entry)
  8. 2716883Domain d1qgta_: 1qgt A: [18135]

Details for d1qgta_

PDB Entry: 1qgt (more details), 3.3 Å

PDB Description: human hepatitis b viral capsid (hbcag)
PDB Compounds: (A:) protein (hbv capsid protein)

SCOPe Domain Sequences for d1qgta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgta_ a.62.1.1 (A:) Hepatitis B viral capsid (hbcag) {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail
cwgelmtlatwvgnnledpasrdlvvnyvntnmglkirqllwfhiscltfgretvleylv
sfgvwirtppayrppnapilst

SCOPe Domain Coordinates for d1qgta_:

Click to download the PDB-style file with coordinates for d1qgta_.
(The format of our PDB-style files is described here.)

Timeline for d1qgta_: