Lineage for d3mkia_ (3mki A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020129Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 1020130Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1020131Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (18 PDB entries)
  8. 1020149Domain d3mkia_: 3mki A: [181345]
    automated match to d1iska_
    complexed with gol, so4

Details for d3mkia_

PDB Entry: 3mki (more details), 2 Å

PDB Description: crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi)
PDB Compounds: (A:) steroid delta-isomerase

SCOPe Domain Sequences for d3mkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkia_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
ihag

SCOPe Domain Coordinates for d3mkia_:

Click to download the PDB-style file with coordinates for d3mkia_.
(The format of our PDB-style files is described here.)

Timeline for d3mkia_: