Lineage for d3mkbd_ (3mkb D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688717Species Isurus oxyrinchus [TaxId:57983] [189618] (1 PDB entry)
  8. 2688721Domain d3mkbd_: 3mkb D: [181342]
    automated match to d1gcvb_
    complexed with hem

Details for d3mkbd_

PDB Entry: 3mkb (more details), 1.9 Å

PDB Description: crystal structure determination of shortfin mako (isurus oxyrinchus) hemoglobin at 1.9 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3mkbd_:

Sequence, based on SEQRES records: (download)

>d3mkbd_ a.1.1.2 (D:) automated matches {Isurus oxyrinchus [TaxId: 57983]}
vhwtqeerdeivktffsanssaigtkalermfvvfpwtnayfakxxxfsasihaaivvga
lqdavkheddvkaefvniskahadklhidpgsfhlltdsfivelahlkkvaftpfvfavw
ikffqvvidaissqyh

Sequence, based on observed residues (ATOM records): (download)

>d3mkbd_ a.1.1.2 (D:) automated matches {Isurus oxyrinchus [TaxId: 57983]}
vhwtqeerdeivktffsanssaigtkalermfvvfpwtnayffsasihaaivvgalqdav
kheddvkaefvniskahadklhidpgsfhlltdsfivelahlkkvaftpfvfavwikffq
vvidaissqyh

SCOPe Domain Coordinates for d3mkbd_:

Click to download the PDB-style file with coordinates for d3mkbd_.
(The format of our PDB-style files is described here.)

Timeline for d3mkbd_: